PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G379100.1.p
Common NameSETIT_002016mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 240aa    MW: 25015.7 Da    PI: 6.5091
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G379100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.4e-29136189155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++WtpeLH+rFveav++L G + A+Pk+i++lm+v+gLt+e+v+SHLQkYR+
  Seita.5G379100.1.p 136 KARMVWTPELHHRFVEAVAHL-GDKGAVPKAIVRLMNVEGLTRENVASHLQKYRI 189
                         68*******************.999*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.201133192IPR017930Myb domain
SuperFamilySSF466894.66E-19134193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-29135193IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-24136189IPR006447Myb domain, plants
PfamPF002497.3E-10138188IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MLSPRGGRPH DATARAPSSS SSPPRQHAGM GAGAGGASGR VLEWEAGLPA ASELTPVSHP  60
LITPALAAAF RINIAGGAFA AASPFDDSPL AHDSPTSHLS LSCDEDDDDD EDEEGETEDA  120
AASGSGACRG GRAGKKARMV WTPELHHRFV EAVAHLGDKG AVPKAIVRLM NVEGLTRENV  180
ASHLQKYRIY LKRTRNPAAP QPAPHFPTAY GSPFNPQPPS DPSSRSGYCA FPSRDGEKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-21133193262ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0666592e-89AK066659.1 Oryza sativa Japonica Group cDNA clone:J013068K17, full insert sequence.
GenBankAP0032512e-89AP003251.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0446B05.
GenBankAP0149572e-89AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126092e-89CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970554.11e-174PREDICTED: transcription factor PCL1-like
TrEMBLK3XJE31e-172K3XJE3_SETIT; Uncharacterized protein
STRINGSi002016m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.35e-27G2-like family protein